PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G165600.1.p
Common NameLOC101779050, SETIT_036535mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family NAC
Protein Properties Length: 334aa    MW: 36672.5 Da    PI: 7.6599
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G165600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.25.4e-5651301128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL++kv++  + + ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke
  Seita.9G165600.1.p   5 LPPGFRFHPTDEELITYYLTRKVSDFAFAT-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDKE 94 
                         79*************************999.89***************999999************************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++  g lvg+kktLvfy+grapkgekt+Wvmheyrl
  Seita.9G165600.1.p  95 IFH-CGMLVGMKKTLVFYRGRAPKGEKTSWVMHEYRL 130
                         ***.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-643151IPR003441NAC domain
PROSITE profilePS5100560.2155151IPR003441NAC domain
PfamPF023654.1E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELIT YYLTRKVSDF AFATRAIADV DLNKCEPWDL PSKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TDSGYWKTTG KDKEIFHCGM LVGMKKTLVF YRGRAPKGEK  120
TSWVMHEYRL QNKFPYKPNK EEWVVCRVFK KSQIIKIRPP QGSPTMDDSL GHDANASLSE  180
LGELDVSSIL GGFAPAPAAH TSSSSPGGAL HHGAGGESFG HSRVDMSAYM SWMAAANQGA  240
AAAAAAAMLP WATTTTPGLF GNVFAPNQHQ LVQKPLPFAG QPRDLGGFVG NAGSEHAMFA  300
SSLAKVEMEC DQQQPPPPPE QQLAMNESTW RAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-57515117165NO APICAL MERISTEM PROTEIN
1ut4_B6e-57515117165NO APICAL MERISTEM PROTEIN
1ut7_A6e-57515117165NO APICAL MERISTEM PROTEIN
1ut7_B6e-57515117165NO APICAL MERISTEM PROTEIN
4dul_A6e-57515117165NAC domain-containing protein 19
4dul_B6e-57515117165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982400.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK4ACC80.0K4ACC8_SETIT; Uncharacterized protein
STRINGSi036535m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.13e-94NAC domain containing protein 58